MLL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233775

Catalog No. NBP233775

Description

MLL5 Polyclonal specifically detects MLL5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MLL5
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q8IZD2
• Gene Symbols: MLL5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPVSDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTH
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.1.1.43, FLJ10078, HDCMC04P, histone-lysine N-methyltransferase MLL5, KMT2EFLJ14026, Lysine N-methyltransferase 2E, MGC70452, myeloid/lymphoid or mixed-lineage leukemia 5 (trithorax homolog, Drosophila), Myeloid/lymphoid or mixed-lineage leukemia protein 5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55904
• Target Species: Human
• Isotype: IgG

For Research Use Only