MMP-15/MT2-MMP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23261325UL

Catalog No. NB397473

Description

MMP-15/MT2-MMP Polyclonal specifically detects MMP-15/MT2-MMP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MMP-15/MT2-MMP
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 15 (membrane-inserted), matrix metalloproteinase 15 (membrane-inserted), Membrane-type matrix metalloproteinase 2, Membrane-type-2 matrix metalloproteinase, MMP-15, MT2-MMPMT2MMP, MTMMP2MT-MMP 2, SMCP-2matrix metalloproteinase-15
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MMP15
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV
• Quantity: 25 μL
• Research Discipline: Extracellular Matrix
• Gene ID (Entrez): 4324
• Target Species: Human
• Isotype: IgG

For Research Use Only