Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMP-15/MT2-MMP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | MMP-15/MT2-MMP |
---|---|
Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
MMP-15/MT2-MMP Polyclonal specifically detects MMP-15/MT2-MMP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MMP-15/MT2-MMP | |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 15 (membrane-inserted), matrix metalloproteinase 15 (membrane-inserted), Membrane-type matrix metalloproteinase 2, Membrane-type-2 matrix metalloproteinase, MMP-15, MT2-MMPMT2MMP, MTMMP2MT-MMP 2, SMCP-2matrix metalloproteinase-15 | |
MMP15 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Rabbit | |
Extracellular Matrix | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
4324 | |
This antibody was developed against a recombinant protein corresponding to amino acids: RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title