MMP-16/MT3-MMP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169349

Catalog No. NBP169349

Description

MMP-16/MT3-MMP Polyclonal specifically detects MMP-16/MT3-MMP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MMP-16/MT3-MMP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome 8 open reading frame 57, DKFZp761D112, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 16 (membrane-inserted), matrix metalloproteinase 16 (membrane-inserted), matrix metalloproteinase-16, Membrane-type matrix metalloproteinase 3, Membrane-type-3 matrix metalloproteinase, MMP-16, MMPX2, MMP-X2, MT3MMP, MT3-MMPC8orf57, MT-MMP 3, MT-MMP2, MTMMP3, MT-MMP3, Putative transmembrane protein C8orf57
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P51512
• Gene Symbols: MMP16
• Immunogen: Synthetic peptides corresponding to MMP16(matrix metallopeptidase 16 (membrane-inserted)) The peptide sequence was selected from the N terminal of MMP16 (NP_005932). Peptide sequence ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4325
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only