Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMP-19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157094
Description
MMP-19 Polyclonal specifically detects MMP-19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MMP-19 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 3.4.24.-, matrix metallopeptidase 19, matrix metalloproteinase 18, matrix metalloproteinase 19, Matrix metalloproteinase RASI, Matrix metalloproteinase-18, matrix metalloproteinase-19, MMP-18, MMP18MMP-19, RASI, RASI-1 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Equine 79%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q99542 | |
| MMP19 | |
| Synthetic peptides corresponding to MMP19 (matrix metallopeptidase 19) The peptide sequence was selected from the C terminal of MMP19. Peptide sequence IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS. | |
| 100 μL | |
| Angiogenesis, Cancer, Extracellular Matrix | |
| 4327 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction