Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MMP-2 Antibody, Novus Biologicals™

MMP-2 Antibody, Novus Biologicals™
SDP

Catalog No. NB404109 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB404109 25 μL
NBP254667 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB404109 Supplier Novus Biologicals Supplier No. NBP25466725UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MMP-2 Polyclonal specifically detects MMP-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen MMP-2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias 72 kDa gelatinase, CLG4, CLG4A72 kDa type IV collagenase, collagenase type IV-A, EC 3.4.24, EC 3.4.24.24, Gelatinase A, matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IVcollagenase), matrix metalloproteinase 2 (gelatinase A, 72kD gelatinase, 72kD type IVcollagenase), Matrix metalloproteinase-2, matrix metalloproteinase-II, MMP-2, MMP-II, MONA, neutrophil gelatinase, TBE-1matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IVcollagenase)
Gene Symbols MMP2
Host Species Rabbit
Immunogen This antibody was developed against a Recombinant Protein corresponding to amino acids:YGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Apoptosis, Cancer, Cell Biology, Cytoskeleton Markers, Extracellular Matrix, HIF Target Genes, Hypoxia, Metastasis, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 4313
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.