MMP-24/MT5-MMP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159458

Catalog No. NBP159458

Description

MMP-24/MT5-MMP Polyclonal specifically detects MMP-24/MT5-MMP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MMP-24/MT5-MMP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 24 (membrane-inserted), matrix metalloproteinase 24 (membrane-inserted), matrix metalloproteinase-24, membrane-type 5 matrix metalloproteinase, Membrane-type matrix metalloproteinase 5, Membrane-type-5 matrix metalloproteinase, MMP-24, MT5MMP, MT5-MMPMMP25, MT-MMP 5, MTMMP5, MT-MMP5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10893
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y5R2
• Gene Symbols: MMP24
• Immunogen: Synthetic peptides corresponding to MMP24(matrix metallopeptidase 24 (membrane-inserted)) The peptide sequence was selected from the middle region of MMP24 (NP_006681). Peptide sequence GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Chicken: 85%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG