Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMP20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
Antigen | MMP20 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16232220
![]() |
Novus Biologicals
NBP16232220UL |
20 μL |
Each for $158.00
|
|
|||||
NBP162322
![]() |
Novus Biologicals
NBP162322 |
100 μL |
Each for $487.50
|
|
|||||
Description
MMP20 Polyclonal specifically detects MMP20 in Human samples. It is validated for Western Blot.Specifications
MMP20 | |
Polyclonal | |
Rabbit | |
O60882 | |
9313 | |
Synthetic peptides corresponding to MMP20(matrix metallopeptidase 20) The peptide sequence was selected from the middle region of MMP20. Peptide sequence AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
AI2A2, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.22, EC 3.4.24.35, Enamel metalloproteinase, Enamelysin, matrix metallopeptidase 20, matrix metalloproteinase 20 (enamelysin), matrix metalloproteinase-20, MMP-20 | |
MMP20 | |
IgG | |
43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title