Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MMP20 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen MMP20
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16232220
View Documents
Novus Biologicals
NBP16232220UL
20 μL
Each for $152.22
Add to cart
 
NBP162322
View Documents
Novus Biologicals
NBP162322
100 μL
Each for $436.00
Add to cart
 
Description

Description

MMP20 Polyclonal specifically detects MMP20 in Human samples. It is validated for Western Blot.
Specifications

Specifications

MMP20
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
AI2A2, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.22, EC 3.4.24.35, Enamel metalloproteinase, Enamelysin, matrix metallopeptidase 20, matrix metalloproteinase 20 (enamelysin), matrix metalloproteinase-20, MMP-20
MMP20
IgG
Affinity Purified
43 kDa
Western Blot
Unconjugated
RUO
O60882
9313
Synthetic peptides corresponding to MMP20(matrix metallopeptidase 20) The peptide sequence was selected from the middle region of MMP20. Peptide sequence AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit