MNAB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438661	Novus Biologicals NBP21321225UL	25ul
NBP213212	Novus Biologicals NBP213212	0.1 mL

Description

MNAB Polyclonal specifically detects MNAB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MNAB
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164
• Gene Symbols: RC3H2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Zinc Finger
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 54542
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GAISRSSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATSSAHYVERDRFIVTDLSGHRKHSSTGDLLSLELQQAKSNSLLLQ
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only