Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MNK2 Antibody, Novus Biologicals™

MNK2 Antibody, Novus Biologicals™
SDP

Catalog No. NB392841 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392841 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392841 Supplier Novus Biologicals Supplier No. NBP26890125UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MNK2 Polyclonal antibody specifically detects MNK2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen MNK2
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias EC 2.7.11, EC 2.7.11.1, G protein-coupled receptor kinase 7, GPRK7Putative map kinase interacting kinase, MAP kinase interacting serine/threonine kinase 2, MAP kinase signal-integrating kinase 2, Mnk2, MNK2MAP kinase-interacting serine/threonine-protein kinase 2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: AIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQ
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 2872
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.