MOBKL1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25764325UL

Catalog No. NB393857

Description

MOBKL1B Polyclonal specifically detects MOBKL1B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MOBKL1B
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C2orf6, chromosome 2 open reading frame 6, FLJ10788, FLJ11595, MATS1, MOB1, Mob1 alpha, Mob1 homolog 1B, MOB1, Mps One Binder kinase activator-like 1B (yeast), mob1A, Mob4B, MOBK1B, mps one binder kinase activator-like 1B, Protein Mob4B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MOB1A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 55233
• Target Species: Human
• Isotype: IgG

For Research Use Only