Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MOBKL1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	MOBKL1B
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP257643 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP257643	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393857 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25764325UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

MOBKL1B Polyclonal specifically detects MOBKL1B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	MOBKL1B
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cancer
Gene Alias	C2orf6, chromosome 2 open reading frame 6, FLJ10788, FLJ11595, MATS1, MOB1, Mob1 alpha, Mob1 homolog 1B, MOB1, Mps One Binder kinase activator-like 1B (yeast), mob1A, Mob4B, MOBK1B, mps one binder kinase activator-like 1B, Protein Mob4B
Gene Symbols	MOB1A
Isotype	IgG
Purification Method	Affinity Purified

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene ID (Entrez)	55233
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

MOBKL1B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents