MOBKL2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168979

Catalog No. NBP168979

Description

MOBKL2A Polyclonal specifically detects MOBKL2A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MOBKL2A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MOB LAK, Mob1 homolog 2A, MOB1, Mps One Binder kinase activator-like 2A (yeast), MOB3A, moblak, MOB-LAKmps one binder kinase activator-like 2A, Protein Mob3A
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%; Porcine: 80%; Guinea pig: 80%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96BX8
• Gene Symbols: MOB3A
• Immunogen: Synthetic peptides corresponding to MOBKL2A (MOB1, Mps One Binder kinase activator-like 2A (yeast)) The peptide sequence was selected from the middle region of MOBKL2A. Peptide sequence EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126308
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.