MORC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256825

Catalog No. NBP256825

Description

MORC3 Polyclonal specifically detects MORC3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MORC3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: KIAA0136, MORC family CW-type zinc finger 3, MORC family CW-type zinc finger protein 3, nuclear matrix protein NXP2, NXP2, ZCW5, ZCWCC3, Zinc finger CW-type coiled-coil domain protein 3, zinc finger, CW type with coiled-coil domain 3, zinc finger, CW-type with coiled-coil domain 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23515
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MORC3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILR
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only