Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MOS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15821220UL
Description
MOS Polyclonal specifically detects MOS in Human, Bovine samples. It is validated for Western Blot.Specifications
MOS | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P00540 | |
MOS | |
Synthetic peptides corresponding to MOS(v-mos Moloney murine sarcoma viral oncogene homolog) The peptide sequence was selected from the middle region of MOS. Peptide sequence LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG. | |
20 μL | |
Cell Cycle and Replication | |
4342 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
c-mos, EC 2.7.11, EC 2.7.11.1, MGC119962, MGC119963, MSV, oncogene MOS, Moloney murine sarcoma virus, Oocyte maturation factor mos, Proto-oncogene c-Mos, proto-oncogene serine/threonine-protein kinase mos, v-mos Moloney murine sarcoma viral oncogene homolog | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction