MOS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158212

Catalog No. NBP158212

Description

MOS Polyclonal specifically detects MOS in Human, Bovine samples. It is validated for Western Blot.

Specifications

• Antigen: MOS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: c-mos, EC 2.7.11, EC 2.7.11.1, MGC119962, MGC119963, MSV, oncogene MOS, Moloney murine sarcoma virus, Oocyte maturation factor mos, Proto-oncogene c-Mos, proto-oncogene serine/threonine-protein kinase mos, v-mos Moloney murine sarcoma viral oncogene homolog
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Chicken: 90%; Guinea pig: 85%.
• Target Species: Human, Bovine, Rat, Pig, Canine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P00540
• Gene Symbols: MOS
• Immunogen: Synthetic peptides corresponding to MOS(v-mos Moloney murine sarcoma viral oncogene homolog) The peptide sequence was selected from the middle region of MOS. Peptide sequence LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 4342
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.