Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MOS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158212
Description
MOS Polyclonal specifically detects MOS in Human, Bovine samples. It is validated for Western Blot.Specifications
| MOS | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| c-mos, EC 2.7.11, EC 2.7.11.1, MGC119962, MGC119963, MSV, oncogene MOS, Moloney murine sarcoma virus, Oocyte maturation factor mos, Proto-oncogene c-Mos, proto-oncogene serine/threonine-protein kinase mos, v-mos Moloney murine sarcoma viral oncogene homolog | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Chicken: 90%; Guinea pig: 85%. | |
| Human, Bovine, Rat, Pig, Canine, Canine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P00540 | |
| MOS | |
| Synthetic peptides corresponding to MOS(v-mos Moloney murine sarcoma viral oncogene homolog) The peptide sequence was selected from the middle region of MOS. Peptide sequence LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG. | |
| 100 μL | |
| Cell Cycle and Replication | |
| 4342 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction