AKAP11, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-488	50 μL

Catalog No. 89-106-488 Supplier Abnova Corporation Supplier No. H00011215A01

Description

Mouse polyclonal antibody raised against a partial recombinant AKAP11.

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed at high levels throughout spermatogenesis and in mature sperm. It binds the RI and RII subunits of PKA in testis. It may serve a function in cell cycle control of both somatic cells and germ cells in addition to its putative role in spermatogenesis and sperm function. [provided by RefSeq

Sequence: EGLGQDGKTLLITNIDMEPCTVDPQLRIILQWLIASEAEVAELYFHDSANKEFMLLSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERCKSLFDWLLENA

Specifications

• Antigen: AKAP11
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant AKAP11.
• Formulation: 50% glycerol
• Gene: AKAP11
• Gene Accession No.: NM_016248
• Gene Alias: AKAP220/DKFZp781I12161/FLJ11304/KIAA0629/PRKA11
• Gene Symbols: AKAP11
• Host Species: Mouse
• Immunogen: AKAP11 (NP_057332, 1801 a.a. to 1901 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11215
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only