AP1S2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-976	50 μL

Catalog No. 89-105-976

Supplier: Abnova Corporation H00008905A01

Description

Mouse polyclonal antibody raised against a full-length recombinant AP1S2.

Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq

Sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT

Specifications

• Antigen: AP1S2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant AP1S2.
• Formulation: 50% glycerol
• Gene: AP1S2
• Gene Accession No.: BC001117
• Gene Alias: DC22/MGC:1902/MRX59/SIGMA1B
• Gene Symbols: AP1S2
• Host Species: Mouse
• Immunogen: AP1S2 (AAH01117, 1 a.a. to 157 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8905
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only