Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Mouse anti-GRASP55, Clone: CL2522, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP236769

Catalog No. NBP236769


Add to cart

Description

Description

GRASP55 Monoclonal antibody specifically detects GRASP55 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

GRASP55
CL2522
Western Blot 1:500-1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000-1:10000
Q9H8Y8
Golgi phosphoprotein 6, golgi reassembly stacking protein 2, 55 kDa, golgi reassembly stacking protein 2, 55kDa, Golgi reassembly-stacking protein of 55 kDa, GOLPH6DKFZp434D156, GRASP55FLJ13139, GRS2Golgi reassembly-stacking protein 2, p59
Mouse
IgG1
0.1 ml
Golgi Apparatus Markers
Primary
26003
Protein A purified
Western Blot, Immunohistochemistry
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Purified
GORASP2
This antibody was developed against Recombinant Protein corresponding to amino acids:PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
Protein A purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only