KPNA2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-817	50 μL

Catalog No. 89-104-817 Supplier Abnova Corporation Supplier No. H00003838A01

Description

Mouse polyclonal antibody raised against a partial recombinant KPNA2.

The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination [provided by RefSeq

Sequence: GIIEPLMNLLTAKDTKIILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFN

Specifications

• Antigen: KPNA2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant KPNA2.
• Formulation: 50% glycerol
• Gene: KPNA2
• Gene Accession No.: NM_002266
• Gene Alias: IPOA1/QIP2/RCH1/SRP1alpha
• Gene Symbols: KPNA2
• Host Species: Mouse
• Immunogen: KPNA2 (NP_002257, 420 a.a. ∽ 528 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3838
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only