SYN2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-543	50 μL

Catalog No. 89-105-543

Supplier: Abnova Corporation H00006854A01

Description

Mouse polyclonal antibody raised against a partial recombinant SYN2.

This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family encodes a neuron-specific phosphoprotein that selectively binds to small synaptic vesicles in the presynaptic nerve terminal. The TIMP4 gene is located within an intron of this gene and is transcribed in the opposite direction. Mutations in this gene may be associated with abnormal presynaptic function and schizophrenia. Alternative splicing of this gene results in two transcripts. [provided by RefSeq

Sequence: AMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSRTPALSPQRPLTTQQPQSGTLKDPDSSKT

Specifications

• Antigen: SYN2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SYN2.
• Formulation: 50% glycerol
• Gene: SYN2
• Gene Accession No.: NM_133625
• Gene Alias: SYNII/SYNIIa/SYNIIb
• Gene Symbols: SYN2
• Host Species: Mouse
• Immunogen: SYN2 (NP_598328, 348 a.a. ∽ 448 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6854
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only