MPP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154861

Catalog No. NBP154861

Description

MPP2 Polyclonal specifically detects MPP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MPP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Discs large homolog 2, DKFZp686A06252, DKFZp686J2189, DKFZp761D0712, DLG2discs large, homolog 2, MAGUK p55 subfamily member 2, membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2), Protein MPP2
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9WV34
• Gene Symbols: MPP2
• Immunogen: Synthetic peptides corresponding to MPP2(membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2)) The peptide sequence was selected from the middle region of MPP2. Peptide sequence QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4355
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG