MPPED2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180498

Catalog No. NBP180498

Description

MPPED2 Polyclonal specifically detects MPPED2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MPPED2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 239FBchromosome 11 open reading frame 8, C11orf8dJ1024C24.1, D11S302E, dJ873F21.1, EC 3.1, FAM1B, Fetal brain protein 239, metallophosphoesterase domain containing 2, Metallophosphoesterase domain-containing protein 2, metallophosphoesterase MPPED2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Sumatran orangutan: 100%; Green puffer: 100%; Western clawed frog: 100%; Atlantic salmon: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001575
• Gene Symbols: MPPED2
• Immunogen: Synthetic peptide directed towards the N terminal of human MPPED2. Peptide sequence RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT.
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 744
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.