Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MPST Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15473420UL
Description
MPST Polyclonal specifically detects MPST in Human, Mouse, Rat samples. It is validated for Western Blot.Specifications
| MPST | |
| Polyclonal | |
| Western Blot 0.2-1 ug/ml | |
| P25325 | |
| MPST | |
| Synthetic peptides corresponding to MPST(mercaptopyruvate sulfurtransferase) The peptide sequence was selected from the middle region of MPST. Peptide sequence DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT. | |
| Affinity Purified | |
| RUO | |
| 4357 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| mercaptopyruvate sulfurtransferase, MGC24539, MSThuman liver rhodanese, TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase | |
| Rabbit | |
| 33 kDa | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction