Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MPST Antibody, Novus Biologicals™
SDP

Catalog No. NBP15473420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15473420 20 μL
NBP154734 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15473420 Supplier Novus Biologicals Supplier No. NBP15473420UL

Rabbit Polyclonal Antibody

MPST Polyclonal specifically detects MPST in Human, Mouse, Rat samples. It is validated for Western Blot.

Specifications

Antigen MPST
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P25325
Gene Alias mercaptopyruvate sulfurtransferase, MGC24539, MSThuman liver rhodanese, TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase
Gene Symbols MPST
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MPST(mercaptopyruvate sulfurtransferase) The peptide sequence was selected from the middle region of MPST. Peptide sequence DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT.
Molecular Weight of Antigen 33 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4357
Target Species Human, Mouse, Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.