MRG15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15783220UL

Catalog No. NBP15783220

Description

MRG15 Polyclonal specifically detects MRG15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRG15
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q86YT7
• Gene Symbols: MORF4L1
• Immunogen: Synthetic peptides corresponding to MORF4L1 (mortality factor 4 like 1) The peptide sequence was selected from the middle region of MORF4L1. Peptide sequence YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Eaf3, Esa1p-associated factor 3 homolog, HsT17725, MEAF3, MGC10631, MORF-related gene on chromosome 15, MORFRG15, mortality factor 4 like 1, mortality factor 4-like protein 1, MRG15MORF-related gene 15 protein, Protein MSL3-1, S863-6, Transcription factor-like protein MRG15
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10933
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG