Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MRG15 Antibody, Novus Biologicals™

MRG15 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15783220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15783220 20 μL
NBP157832 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15783220 Supplier Novus Biologicals Supplier No. NBP15783220UL

Description

Rabbit Polyclonal Antibody

MRG15 Polyclonal specifically detects MRG15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen MRG15
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q86YT7
Gene Alias Eaf3, Esa1p-associated factor 3 homolog, HsT17725, MEAF3, MGC10631, MORF-related gene on chromosome 15, MORFRG15, mortality factor 4 like 1, mortality factor 4-like protein 1, MRG15MORF-related gene 15 protein, Protein MSL3-1, S863-6, Transcription factor-like protein MRG15
Gene Symbols MORF4L1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MORF4L1 (mortality factor 4 like 1) The peptide sequence was selected from the middle region of MORF4L1. Peptide sequence YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10933
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.