Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRG15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
Antigen | MRG15 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15783220
![]() |
Novus Biologicals
NBP15783220UL |
20 μL |
Each for $158.00
|
|
|||||
NBP157832
![]() |
Novus Biologicals
NBP157832 |
100 μL |
Each for $487.50
|
|
|||||
Description
MRG15 Polyclonal specifically detects MRG15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MRG15 | |
Polyclonal | |
Purified | |
RUO | |
Eaf3, Esa1p-associated factor 3 homolog, HsT17725, MEAF3, MGC10631, MORF-related gene on chromosome 15, MORFRG15, mortality factor 4 like 1, mortality factor 4-like protein 1, MRG15MORF-related gene 15 protein, Protein MSL3-1, S863-6, Transcription factor-like protein MRG15 | |
MORF4L1 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Q86YT7 | |
10933 | |
Synthetic peptides corresponding to MORF4L1 (mortality factor 4 like 1) The peptide sequence was selected from the middle region of MORF4L1. Peptide sequence YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title