Learn More
Description
Specifications
Specifications
| Antigen | MRGX3 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | G protein-coupled receptor MRGX3, G protein-coupled receptor SNSR2, GPCR, mas-related GPCR member X3, MAS-related GPR, member X3, mas-related G-protein coupled receptor member X3, MRGX3G protein-coupled receptor SNSR1, Sensory neuron-specific G-protein coupled receptor 1/2, SNSR1, SNSR2 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MRGX3 (NP_473372). Peptide sequence FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGWL |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
