MRP1 Antibody (IU5C1) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NB11057131

Catalog No. NB11057131

Description

MRP1 Monoclonal specifically detects MRP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRP1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with 0.1% Sodium Azide
• Gene Alias: ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein
• Host Species: Mouse
• Molecular Weight of Antigen: 172 kDa
• Quantity: 0.1 mL
• Research Discipline: ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction
• Gene ID (Entrez): 4363
• Target Species: Human, Mouse
• Form: Ascites

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Clone: IU5C1
• Dilution: Western Blot 1:250 - 1:500, Immunohistochemistry 1:200, Immunocytochemistry/Immunofluorescence reported in scientific literature, Immunohistochemistry-Paraffin 1:200
• Gene Accession No.: P33527
• Gene Symbols: ABCC1
• Immunogen: A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]
• Purification Method: Protein G purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG1

For Research Use Only