Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MRP1 Antibody (IU5C1) - BSA Free, Novus Biologicals™
SDP

Catalog No. NB11057131T Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.025 mL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB11057131T 0.025 mL
NB11057131 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB11057131T Supplier Novus Biologicals Supplier No. NB11057131SS
Add to Cart
Add to Cart

Mouse Monoclonal Antibody has been used in 1 publication

MRP1 Monoclonal specifically detects MRP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen MRP1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone IU5C1
Conjugate Unconjugated
Dilution Western Blot 1:250 - 1:500, Immunohistochemistry 1:200, Immunocytochemistry/Immunofluorescence reported in scientific literature, Immunohistochemistry-Paraffin 1:200
Formulation PBS with 0.1% Sodium Azide
Gene Accession No. P33527
Gene Alias ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein
Gene Symbols ABCC1
Host Species Mouse
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]
Molecular Weight of Antigen 172 kDa
Purification Method Protein G purified
Quantity 0.025 mL
Regulatory Status RUO
Research Discipline ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4363
Test Specificity Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Ascites
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.