Learn More
Description
Specifications
Specifications
| Antigen | MRP1 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | IU5C1 |
| Conjugate | mFluor Violet 610 SE |
| Dilution | Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin |
| Formulation | 50mM Sodium Borate |
| Gene Alias | ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein |
| Host Species | Mouse |
| Immunogen | A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
