Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB339266

MRP1 Antibody (IU5C1), PE, Novus Biologicals™
SDP

Catalog No. NB339266 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB339266 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB339266 Supplier Novus Biologicals Supplier No. NB11057131PE
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

MRP1 Monoclonal antibody specifically detects MRP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen MRP1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone IU5C1
Conjugate PE
Dilution Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
Formulation PBS
Gene Alias ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein
Host Species Mouse
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]
Purification Method Protein G purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4363
Target Species Human, Mouse
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.