MRPL14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25736325UL

Catalog No. NB394010

Description

MRPL14 Polyclonal specifically detects MRPL14 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MRPL14
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: L14mt, L32mt, mitochondrial ribosomal protein L14, MRPL32MGC70566,39S ribosomal protein L32, mitochondrial, MRP-L32MRP-L14, RMPL32, RPML3239S ribosomal protein L14, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64928
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MRPL14
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHVYKKNGVGKVGDQILLAIK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only