MRPL28 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP154657	100 μL

Catalog No. NBP154657 Supplier Novus Biologicals Supplier No. NBP154657

Description

Rabbit Polyclonal Antibody

MRPL28 Polyclonal specifically detects MRPL28 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MRPL28
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q13084
• Gene Alias: L28mt, MAAT139S ribosomal protein L28, mitochondrial, Melanoma antigen p15, melanoma-associated antigen recognised by cytotoxic T lymphocytes, Melanoma-associated antigen recognized by T lymphocytes, MGC8499, mitochondrial ribosomal protein L28, MRP-L28, p15
• Gene Symbols: MRPL28
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to MRPL28(mitochondrial ribosomal protein L28) The peptide sequence was selected from the middle region of MRPL28. Peptide sequence EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK.
• Molecular Weight of Antigen: 30 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Primary or Secondary: Primary
• Gene ID (Entrez): 10573
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only