MRPL47 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25584425UL

Catalog No. NB403859

Description

MRPL47 Polyclonal specifically detects MRPL47 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MRPL47
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: CGI-204, L47mt, MGC45403, mitochondrial ribosomal protein L47, MRP-L47, nasopharyngeal carcinoma metastasis-related 1, Nasopharyngeal carcinoma metastasis-related protein 1, NCM139S ribosomal protein L47, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MRPL47
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAEAQKSSLV
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 57129
• Target Species: Human
• Isotype: IgG

For Research Use Only