MRPL49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168932

Catalog No. NBP168932

Description

MRPL49 Polyclonal specifically detects MRPL49 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MRPL49
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C11orf4, L49mt39S ribosomal protein L49, mitochondrial, mitochondrial ribosomal protein L49, MRP-L49, Neighbor of FAU, next to FAU, NOF1chromosome 11 open reading frame 4, NOFMGC10656, Protein NOF1
• Host Species: Rabbit
• Molecular Weight of Antigen: 19 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 740
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q13405
• Gene Symbols: MRPL49
• Immunogen: Synthetic peptides corresponding to MRPL49 (mitochondrial ribosomal protein L49) The peptide sequence was selected from the N terminal of MRPL49. Peptide sequence ESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Mouse: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG