Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MRPL49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	MRPL49
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16893220 View Documents View Product Certificates	Novus Biologicals NBP16893220UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP168932 View Documents View Product Certificates	Novus Biologicals NBP168932	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

MRPL49 Polyclonal specifically detects MRPL49 in Human samples. It is validated for Western Blot.

Specifications

Antigen	MRPL49
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Stem Cell Markers
Gene Alias	C11orf4, L49mt39S ribosomal protein L49, mitochondrial, mitochondrial ribosomal protein L49, MRP-L49, Neighbor of FAU, next to FAU, NOF1chromosome 11 open reading frame 4, NOFMGC10656, Protein NOF1
Gene Symbols	MRPL49
Isotype	IgG
Molecular Weight of Antigen	19 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q13405
Gene ID (Entrez)	740
Immunogen	Synthetic peptides corresponding to MRPL49 (mitochondrial ribosomal protein L49) The peptide sequence was selected from the N terminal of MRPL49. Peptide sequence ESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRS.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

MRPL49 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents