Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRPL49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16893220UL
Description
MRPL49 Polyclonal specifically detects MRPL49 in Human samples. It is validated for Western Blot.Specifications
MRPL49 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q13405 | |
MRPL49 | |
Synthetic peptides corresponding to MRPL49 (mitochondrial ribosomal protein L49) The peptide sequence was selected from the N terminal of MRPL49. Peptide sequence ESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRS. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C11orf4, L49mt39S ribosomal protein L49, mitochondrial, mitochondrial ribosomal protein L49, MRP-L49, Neighbor of FAU, next to FAU, NOF1chromosome 11 open reading frame 4, NOFMGC10656, Protein NOF1 | |
Rabbit | |
19 kDa | |
20 μL | |
Stem Cell Markers | |
740 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction