Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MRPS6 Antibody, Novus Biologicals™

MRPS6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15696220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15696220 20 μL
NBP156962 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15696220 Supplier Novus Biologicals Supplier No. NBP15696220UL

Description

Rabbit Polyclonal Antibody

MRPS6 Polyclonal specifically detects MRPS6 in Human samples. It is validated for Western Blot.

Specifications

Antigen MRPS6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P82932
Gene Alias C21orf101, mitochondrial ribosomal protein S6, MRP-S6chromosome 21 open reading frame 101, RPMS628S ribosomal protein S6, mitochondrial, S6mt
Gene Symbols MRPS6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MRPS6 (mitochondrial ribosomal protein S6) The peptide sequence was selected from the middle region of MRPS6. Peptide sequence VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64968
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.