Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MS4A14 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31760425UL
Description
MS4A14 Polyclonal antibody specifically detects MS4A14 in Human samples. It is validated for ImmunofluorescenceSpecifications
MS4A14 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
DKFZp434H092, FLJ32856, membrane-spanning 4-domains subfamily A member 14, membrane-spanning 4-domains, subfamily A, member 14, membrane-spanning 4-domains, subfamily A, member 16, MGC104289, MGC49828, MS4A13, MS4A13 protein, MS4A16, NYD-SP21, testes development-related NYD-SP21, Testis development protein NYD-SP21 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: DQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPP | |
25 μg | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
84689 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction