MS4A4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16000620UL

Catalog No. NBP16000620

Description

MS4A4A Polyclonal specifically detects MS4A4A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MS4A4A
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q96JQ5
• Gene Symbols: MS4A4A
• Immunogen: Synthetic peptides corresponding to MS4A4A(membrane-spanning 4-domains, subfamily A, member 4) The peptide sequence was selected from the N terminal of MS4A4A. Peptide sequence MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51338
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 4SPAN1, CD20 antigen-like 1, CD20L1CD20-L1, Fc epsilon receptor beta subunit homolog, Four-span transmembrane protein 1, membrane-spanning 4-domains subfamily A member 4A, membrane-spanning 4-domains, subfamily A, member 4, membrane-spanning 4-domains, subfamily A, member 4A, MS4A4MGC22311, MS4A7
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG