Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MS4A4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | MS4A4A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16000620
|
Novus Biologicals
NBP16000620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP160006
|
Novus Biologicals
NBP160006 |
100 μL |
Each for $487.50
|
|
|||||
Description
MS4A4A Polyclonal specifically detects MS4A4A in Human samples. It is validated for Western Blot.Specifications
| MS4A4A | |
| Polyclonal | |
| Rabbit | |
| Q96JQ5 | |
| 51338 | |
| Synthetic peptides corresponding to MS4A4A(membrane-spanning 4-domains, subfamily A, member 4) The peptide sequence was selected from the N terminal of MS4A4A. Peptide sequence MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 4SPAN1, CD20 antigen-like 1, CD20L1CD20-L1, Fc epsilon receptor beta subunit homolog, Four-span transmembrane protein 1, membrane-spanning 4-domains subfamily A member 4A, membrane-spanning 4-domains, subfamily A, member 4, membrane-spanning 4-domains, subfamily A, member 4A, MS4A4MGC22311, MS4A7 | |
| MS4A4A | |
| IgG | |
| 26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title