MS4A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18654025UL

Catalog No. NB431875

Description

MS4A7 Polyclonal specifically detects MS4A7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MS4A7
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50
• Gene Alias: CD20/FC-epsilon-RI-beta family member 4, CD20L4MGC22368, CFFM4CD20 antigen-like 4, Four-span transmembrane protein 2, high affinity immunoglobulin epsilon receptor beta subunit, membrane-spanning 4-domains subfamily A member 7, membrane-spanning 4-domains, subfamily A, member 7,4SPAN2, MS4A8
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 58475
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MS4A7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only