Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MS4A7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $648.50
Specifications
| Antigen | MS4A7 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MS4A7 Polyclonal specifically detects MS4A7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MS4A7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CD20/FC-epsilon-RI-beta family member 4, CD20L4MGC22368, CFFM4CD20 antigen-like 4, Four-span transmembrane protein 2, high affinity immunoglobulin epsilon receptor beta subunit, membrane-spanning 4-domains subfamily A member 7, membrane-spanning 4-domains, subfamily A, member 7,4SPAN2, MS4A8 | |
| MS4A7 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 58475 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title