MS4A8B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18102525UL

Catalog No. NB433981

Description

MS4A8B Polyclonal specifically detects MS4A8B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MS4A8B
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Accession No.: Q9BY19
• Gene Symbols: MS4A8
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 4SPAN4, Four-span transmembrane protein 4, membrane-spanning 4-domains subfamily A member 8B, membrane-spanning 4-domains, subfamily A, member 8B, MS4A4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83661
• Target Species: Human
• Isotype: IgG

For Research Use Only