Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MSH4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15819820UL
Description
MSH4 Polyclonal specifically detects MSH4 in Human samples. It is validated for Western Blot.Specifications
MSH4 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O15457 | |
MSH4 | |
Synthetic peptides corresponding to MSH4(mutS homolog 4 (E. coli)) The peptide sequence was selected from the middle region of MSH4. Peptide sequence EITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIY. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
hMSH4, mutS (E. coli) homolog 4, mutS homolog 4 (E. coli), mutS protein homolog 4 | |
Rabbit | |
Affinity Purified | |
RUO | |
4438 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction