Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MSH4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15817020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15817020 20 μL
NBP158170 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15817020 Supplier Novus Biologicals Supplier No. NBP15817020UL

Rabbit Polyclonal Antibody

MSH4 Polyclonal specifically detects MSH4 in Human samples. It is validated for Western Blot.

Specifications

Antigen MSH4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. O15457
Gene Alias hMSH4, mutS (E. coli) homolog 4, mutS homolog 4 (E. coli), mutS protein homolog 4
Gene Symbols MSH4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MSH4(mutS homolog 4 (E. coli)) The peptide sequence was selected from the N terminal of MSH4. Peptide sequence SSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVGYSASSSSAISAHSPSV.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline DNA Repair, Mismatch Repair
Primary or Secondary Primary
Gene ID (Entrez) 4438
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.