MSL2L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152987

Catalog No. NBP152987

Description

MSL2L1 Polyclonal specifically detects MSL2L1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MSL2L1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ10546, KIAA1585FLJ54913, male-specific lethal 2 homolog, male-specific lethal 2 homolog (Drosophila), Male-specific lethal 2-like 1, male-specific lethal 2-like 1 (Drosophila), Male-specific lethal-2 homolog 1, MSL-2, MSL2L1, MSL2-like 1, PHNPCC4, PMS2, RING finger protein 184msl-2, RNF184
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55167
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9HCI7
• Gene Symbols: MSL2
• Immunogen: Synthetic peptides corresponding to MSL2L1(male-specific lethal 2-like 1 (Drosophila)) The peptide sequence was selected from the N terminal of MSL2L1. Peptide sequence NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Mouse: 100%; Human: 100%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG