Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MSL2L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MSL2L1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MSL2L1 Polyclonal specifically detects MSL2L1 in Human samples. It is validated for Western Blot.Specifications
MSL2L1 | |
Polyclonal | |
Rabbit | |
Q9HCI7 | |
55167 | |
Synthetic peptides corresponding to MSL2L1(male-specific lethal 2-like 1 (Drosophila)) The peptide sequence was selected from the N terminal of MSL2L1. Peptide sequence NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ10546, KIAA1585FLJ54913, male-specific lethal 2 homolog, male-specific lethal 2 homolog (Drosophila), Male-specific lethal 2-like 1, male-specific lethal 2-like 1 (Drosophila), Male-specific lethal-2 homolog 1, MSL-2, MSL2L1, MSL2-like 1, PHNPCC4, PMS2, RING finger protein 184msl-2, RNF184 | |
MSL2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title