MTCH2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154791

Catalog No. NBP154791

Description

MTCH2 Polyclonal specifically detects MTCH2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MTCH2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 2310034D24Rik, Met-induced mitochondrial protein, MIMP, mitochondrial carrier 2, mitochondrial carrier homolog 2, mitochondrial carrier homolog 2 (C. elegans)
• Host Species: Rabbit
• Molecular Weight of Antigen: 33 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Dog: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y6C9
• Gene Symbols: MTCH2
• Immunogen: Synthetic peptides corresponding to MTCH2(mitochondrial carrier homolog 2 (C. elegans)) The peptide sequence was selected from the N terminal of MTCH2. Peptide sequence TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23788
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.