Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTCH2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154791

 View more versions of this product

Catalog No. NBP154791


Only null left
Add to Cart

Description

Description

MTCH2 Polyclonal specifically detects MTCH2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

MTCH2
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
2310034D24Rik, Met-induced mitochondrial protein, MIMP, mitochondrial carrier 2, mitochondrial carrier homolog 2, mitochondrial carrier homolog 2 (C. elegans)
Rabbit
33 kDa
100 μL
Primary
Dog: 79%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q9Y6C9
MTCH2
Synthetic peptides corresponding to MTCH2(mitochondrial carrier homolog 2 (C. elegans)) The peptide sequence was selected from the N terminal of MTCH2. Peptide sequence TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV.
Affinity purified
RUO
23788
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.